Lineage for d1f75b_ (1f75 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526295Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2526296Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2526297Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2526298Protein Undecaprenyl diphosphate synthase [64007] (3 species)
  7. 2526337Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry)
  8. 2526339Domain d1f75b_: 1f75 B: [59663]
    complexed with so4

Details for d1f75b_

PDB Entry: 1f75 (more details), 2.2 Å

PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26
PDB Compounds: (B:) Undecaprenyl pyrophosphate synthetase

SCOPe Domain Sequences for d1f75b_:

Sequence, based on SEQRES records: (download)

>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafstenw
srpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhnt
gltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirt
sgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr

Sequence, based on observed residues (ATOM records): (download)

>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafnylmk
lpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfalnygg
rkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerlsnfliw
qcsysefvfidefwpdfneeslaqcisiyqnr

SCOPe Domain Coordinates for d1f75b_:

Click to download the PDB-style file with coordinates for d1f75b_.
(The format of our PDB-style files is described here.)

Timeline for d1f75b_: