![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
![]() | Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
![]() | Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins) automatically mapped to Pfam PF01255 |
![]() | Protein Undecaprenyl diphosphate synthase [64007] (3 species) |
![]() | Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry) |
![]() | Domain d1f75b_: 1f75 B: [59663] complexed with so4 |
PDB Entry: 1f75 (more details), 2.2 Å
SCOPe Domain Sequences for d1f75b_:
Sequence, based on SEQRES records: (download)
>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]} qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafstenw srpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhnt gltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirt sgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr
>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]} qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafnylmk lpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfalnygg rkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerlsnfliw qcsysefvfidefwpdfneeslaqcisiyqnr
Timeline for d1f75b_: