Lineage for d1f75b_ (1f75 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75761Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
  4. 75762Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) (S)
  5. 75763Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)
  6. 75764Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 75768Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry)
  8. 75770Domain d1f75b_: 1f75 B: [59663]

Details for d1f75b_

PDB Entry: 1f75 (more details), 2.2 Å

PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26

SCOP Domain Sequences for d1f75b_:

Sequence, based on SEQRES records: (download)

>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus}
qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafstenw
srpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhnt
gltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirt
sgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr

Sequence, based on observed residues (ATOM records): (download)

>d1f75b_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Micrococcus luteus}
qipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyafnylmk
lpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfalnygg
rkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerlsnfliw
qcsysefvfidefwpdfneeslaqcisiyqnr

SCOP Domain Coordinates for d1f75b_:

Click to download the PDB-style file with coordinates for d1f75b_.
(The format of our PDB-style files is described here.)

Timeline for d1f75b_: