Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50587] (47 PDB entries) Uniprot P00749 156-178,179-424 |
Domain d1f5ku_: 1f5k U: [59652] complexed with bam, so4 |
PDB Entry: 1f5k (more details), 1.8 Å
SCOPe Domain Sequences for d1f5ku_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5ku_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw irshtke
Timeline for d1f5ku_: