Lineage for d1f5ku_ (1f5k U:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins) 
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50587] (9 PDB entries) 
Domain d1f5ku_: 1f5k U: [59652]
Details for d1f5ku_
PDB Entry: 1f5k (more details), 1.8 Å
PDB Description: urokinase plasminogen activator b-chain-benzamidine complex
SCOP Domain Sequences for d1f5ku_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5ku_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke
SCOP Domain Coordinates for d1f5ku_:
Click to download the PDB-style file with coordinates for d1f5ku_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f5ku_:
- d1f5ku_ is new in SCOP 1.57
- d1f5ku_ appears in SCOP 1.59
- d1f5ku_ appears in the current release, SCOPe 2.08
View in 3D