Lineage for d1f45b_ (1f45 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441656Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 441657Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 441658Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 441695Protein Heterodimeric interleukin-12 alpha chain [63530] (1 species)
  7. 441696Species Human (Homo sapiens) [TaxId:9606] [63531] (1 PDB entry)
  8. 441697Domain d1f45b_: 1f45 B: [59642]
    Other proteins in same PDB: d1f45a1, d1f45a2, d1f45a3

Details for d1f45b_

PDB Entry: 1f45 (more details), 2.8 Å

PDB Description: human interleukin-12

SCOP Domain Sequences for d1f45b_:

Sequence, based on SEQRES records: (download)

>d1f45b_ a.26.1.1 (B:) Heterodimeric interleukin-12 alpha chain {Human (Homo sapiens)}
qnllravsnmlqkarqtlefypctseeidheditkdktstveaclpleltknesclnsre
tsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnmla
videlmqalnfnsetvpqkssleepdfyktkiklcillhafriravtidrvmsylnas

Sequence, based on observed residues (ATOM records): (download)

>d1f45b_ a.26.1.1 (B:) Heterodimeric interleukin-12 alpha chain {Human (Homo sapiens)}
qnllravsnmlqkarqtlefypcstveaclpleltknesctsfitngssfmmalclssiy
edlkmyqvefktmnakllmdpkrqifldqnmlavidelmqalyktkiklcillhafrira
vtidrvmsylnas

SCOP Domain Coordinates for d1f45b_:

Click to download the PDB-style file with coordinates for d1f45b_.
(The format of our PDB-style files is described here.)

Timeline for d1f45b_: