Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (24 proteins) |
Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63673] (2 PDB entries) |
Domain d1f45a3: 1f45 A:212-306 [59641] Other proteins in same PDB: d1f45a1, d1f45b_ |
PDB Entry: 1f45 (more details), 2.8 Å
SCOP Domain Sequences for d1f45a3:
Sequence, based on SEQRES records: (download)
>d1f45a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)} kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk tsatvicrknasisvraqdryyssswsewasvpcs
>d1f45a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)} kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqkdrvftdktsatvic rsisvraqdryyssswsewasvpcs
Timeline for d1f45a3: