![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries) |
![]() | Domain d1f45a2: 1f45 A:88-211 [59640] Other proteins in same PDB: d1f45a1, d1f45b_ |
PDB Entry: 1f45 (more details), 2.8 Å
SCOPe Domain Sequences for d1f45a2:
Sequence, based on SEQRES records: (download)
>d1f45a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffi rdii
>d1f45a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt cgaatlsaeeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii
Timeline for d1f45a2: