SCOPe 2.08: Domain d1f45a1: 1f45 A:1-87

Lineage for d1f45a1 (1f45 A:1-87)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain [63665] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63666] (5 PDB entries)

8. Domain d1f45a1: 1f45 A:1-87 [59639]
   Other proteins in same PDB: d1f45a2, d1f45a3, d1f45b_

Details for d1f45a1

PDB Entry: 1f45, 2.8 Å

PDB Description: human interleukin-12

PDB Compounds: (A:) interleukin-12 beta chain

SCOPe Domain Sequences for d1f45a1:

Sequence, based on SEQRES records:

>d1f45a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

Sequence, based on observed residues (ATOM records):

>d1f45a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytcshsllllhkked

Timeline for d1f45a1:

• d1f45a1 first appeared in SCOP 1.57
  
• d1f45a1 appears in SCOPe 2.07