Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (3 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein Bleomycin resistance protein, BRP [54599] (3 species) Active as dimer |
Species Klebsiella pneumoniae [TaxId:573] [64256] (3 PDB entries) the transposon tn5-encoding bleomycin-binding protein, BlmT |
Domain d1ewjb_: 1ewj B: [59527] |
PDB Entry: 1ewj (more details), 2.5 Å
SCOP Domain Sequences for d1ewjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewjb_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae} tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
Timeline for d1ewjb_: