![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) ![]() |
![]() | Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein) |
![]() | Protein Bleomycin resistance protein, BRP [54599] (3 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [64256] (2 PDB entries) |
![]() | Domain d1ewjb_: 1ewj B: [59527] |
PDB Entry: 1ewj (more details), 2.5 Å
SCOP Domain Sequences for d1ewjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewjb_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae} tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqne
Timeline for d1ewjb_: