Lineage for d1ep9a2 (1ep9 A:185-354)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) Protein Ornithine transcarbamoylase [53676] (6 species) 
Species Human (Homo sapiens) [TaxId:9606] [53680] (4 PDB entries) 
Domain d1ep9a2: 1ep9 A:185-354 [59485]
complexed with cp
Details for d1ep9a2
PDB Entry: 1ep9 (more details), 2.4 Å
PDB Description: human ornithine transcarbamylase: crystallographic insights into substrate recognition and conformational change
PDB Compounds: (A:) ornithine transcarbamylaseSCOPe Domain Sequences for d1ep9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ep9a2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]}
slkgltlswigdgnnilhsimmsaakfgmhlqaatpkgyepdasvtklaeqyakengtkl
lltndpleaahggnvlitdtwismgreeekkkrlqafqgyqvtmktakvaasdwtflhcl
prkpeevddevfysprslvfpeaenrkwtimavmvslltdyspqlqkpkf
SCOPe Domain Coordinates for d1ep9a2:
Click to download the PDB-style file with coordinates for d1ep9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ep9a2:
- d1ep9a2 first appeared in SCOP 1.57
- d1ep9a2 appears in SCOPe 2.06
- d1ep9a2 appears in the current release, SCOPe 2.08
View in 3D
