SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1e8ca3 (1e8c A:104-337)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2137976Family c.72.2.1: MurCDEF [53624] (5 protein domains)
    automatically mapped to Pfam PF08245
  6. 2138001Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64150] (1 species)
  7. 2138002Species Escherichia coli [TaxId:562] [64151] (1 PDB entry)
  8. 2138003Domain d1e8ca3: 1e8c A:104-337 [59379]
    Other proteins in same PDB: d1e8ca1, d1e8ca2, d1e8ca4, d1e8cb1, d1e8cb2, d1e8cb4
    complexed with api, cl, uag

Details for d1e8ca3

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli
PDB Compounds: (A:) udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase

SCOPe Domain Sequences for d1e8ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
psdnlrlvgvtgtngkttttqllaqwsqllgeisavmgtvgngllgkviptenttgsavd
vqhelaglvdqgatfcamevsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaa
kwllysehhcgqaiinaddevgrrwlaklpdavavsmedhinpnchgrwlkatevnyhds
gatirfssswgdgeieshlmgafnvsnlllalatllalgypladllktaarlqp

SCOPe Domain Coordinates for d1e8ca3:

Click to download the PDB-style file with coordinates for d1e8ca3.
(The format of our PDB-style files is described here.)

Timeline for d1e8ca3: