PDB entry 1e8c

View 1e8c on RCSB PDB site
Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli
Class: ligase
Keywords: ligase, peptidoglycan biosynthesis
Deposited on 2000-09-19, released 2001-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase
    Species: Escherichia coli [TaxId:562]
    Gene: MURE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22188 (Start-493)
      • expression tag (494-497)
    Domains in SCOPe 2.07: d1e8ca1, d1e8ca2, d1e8ca3, d1e8ca4
  • Chain 'B':
    Compound: udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase
    Species: Escherichia coli [TaxId:562]
    Gene: MURE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22188 (Start-493)
      • expression tag (494-497)
    Domains in SCOPe 2.07: d1e8cb1, d1e8cb2, d1e8cb3, d1e8cb4
  • Heterogens: CL, UAG, API, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8cA (A:)
    adrnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgva
    aiiaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhepsdnlrlvgvtgtngkt
    tttqllaqwsqllgeisavmgtvgngllgkviptenttgsavdvqhelaglvdqgatfca
    mevsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaakwllysehhcgqaiina
    ddevgrrwlaklpdavavsmedhinpnchgrwlkatevnyhdsgatirfssswgdgeies
    hlmgafnvsnlllalatllalgypladllktaarlqpvcgrmevftapgkptvvvdyaht
    pdalekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadvavvtddnprteep
    raiindilagmldaghakvmegraeavtcavmqakendvvlvagkghedyqivgnqrldy
    sdrvtvarllgviarshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8cA (A:)
    rnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaai
    iaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhepsdnlrlvgvtgtngkttt
    tqllaqwsqllgeisavmgtvgngllgkviptenttgsavdvqhelaglvdqgatfcame
    vsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaakwllysehhcgqaiinadd
    evgrrwlaklpdavavsmedhinpnchgrwlkatevnyhdsgatirfssswgdgeieshl
    mgafnvsnlllalatllalgypladllktaarlqpvcgrmevftapgkptvvvdyahtpd
    alekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadvavvtddnprteepra
    iindilagmldaghakvmegraeavtcavmqakendvvlvagkghedyqivgnqrldysd
    rvtvarllgviarshh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8cB (B:)
    adrnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgva
    aiiaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhepsdnlrlvgvtgtngkt
    tttqllaqwsqllgeisavmgtvgngllgkviptenttgsavdvqhelaglvdqgatfca
    mevsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaakwllysehhcgqaiina
    ddevgrrwlaklpdavavsmedhinpnchgrwlkatevnyhdsgatirfssswgdgeies
    hlmgafnvsnlllalatllalgypladllktaarlqpvcgrmevftapgkptvvvdyaht
    pdalekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadvavvtddnprteep
    raiindilagmldaghakvmegraeavtcavmqakendvvlvagkghedyqivgnqrldy
    sdrvtvarllgviarshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8cB (B:)
    drnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaa
    iiaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhepsdnlrlvgvtgtngktt
    ttqllaqwsqllgeisavmgtvgngllgkviptenttgsavdvqhelaglvdqgatfcam
    evsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaakwllysehhcgqaiinad
    devgrrwlaklpdavavsmedhinpnchgrwlkatevnyhdsgatirfssswgdgeiesh
    lmgafnvsnlllalatllalgypladllktaarlqpvcgrmevftapgkptvvvdyahtp
    dalekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadvavvtddnprteepr
    aiindilagmldaghakvmegraeavtcavmqakendvvlvagkghedyqivgnqrldys
    drvtvarllgviarshh