| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core. |
Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (2 families) ![]() binds UDP group |
| Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins) |
| Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [63951] (1 species) |
| Species Escherichia coli [TaxId:562] [63952] (1 PDB entry) |
| Domain d1e8ca1: 1e8c A:3-103 [59377] Other proteins in same PDB: d1e8ca2, d1e8ca3, d1e8ca4, d1e8cb2, d1e8cb3, d1e8cb4 complexed with api, cl, uag |
PDB Entry: 1e8c (more details), 2 Å
SCOPe Domain Sequences for d1e8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8ca1 c.98.1.1 (A:3-103) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
rnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaai
iaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhe
Timeline for d1e8ca1:
View in 3DDomains from other chains: (mouse over for more information) d1e8cb1, d1e8cb2, d1e8cb3, d1e8cb4 |