Lineage for d1e8ca3 (1e8c A:88-337)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74156Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 74197Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
  5. 74198Family c.72.2.1: MurD/MurE/MurF [53624] (3 proteins)
  6. 74211Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64150] (1 species)
  7. 74212Species Escherichia coli [TaxId:562] [64151] (1 PDB entry)
  8. 74213Domain d1e8ca3: 1e8c A:88-337 [59379]
    Other proteins in same PDB: d1e8ca1, d1e8ca2, d1e8cb1, d1e8cb2

Details for d1e8ca3

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli

SCOP Domain Sequences for d1e8ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ca3 c.72.2.1 (A:88-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli}
qlnerlsalagrfyhepsdnlrlvgvtgtngkttttqllaqwsqllgeisavmgtvgngl
lgkviptenttgsavdvqhelaglvdqgatfcamevsshglvqhrvaalkfaasvftnls
rdhldyhgdmehyeaakwllysehhcgqaiinaddevgrrwlaklpdavavsmedhinpn
chgrwlkatevnyhdsgatirfssswgdgeieshlmgafnvsnlllalatllalgyplad
llktaarlqp

SCOP Domain Coordinates for d1e8ca3:

Click to download the PDB-style file with coordinates for d1e8ca3.
(The format of our PDB-style files is described here.)

Timeline for d1e8ca3: