Lineage for d1e6ba2 (1e6b A:8-87)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168907Protein Class zeta GST [81364] (2 species)
  7. 1168910Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [64059] (1 PDB entry)
  8. 1168911Domain d1e6ba2: 1e6b A:8-87 [59295]
    Other proteins in same PDB: d1e6ba1
    complexed with bme

Details for d1e6ba2

PDB Entry: 1e6b (more details), 1.65 Å

PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1e6ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd
vvindsfaiimyldekypep

SCOPe Domain Coordinates for d1e6ba2:

Click to download the PDB-style file with coordinates for d1e6ba2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ba1