Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class zeta GST [81364] (2 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [64059] (1 PDB entry) |
Domain d1e6ba2: 1e6b A:8-87 [59295] Other proteins in same PDB: d1e6ba1 complexed with bme |
PDB Entry: 1e6b (more details), 1.65 Å
SCOPe Domain Sequences for d1e6ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd vvindsfaiimyldekypep
Timeline for d1e6ba2: