Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.9: C-terminal UvrC-binding domain of UvrB [46600] (1 family) |
Family a.2.9.1: C-terminal UvrC-binding domain of UvrB [46601] (1 protein) |
Protein C-terminal UvrC-binding domain of UvrB [46602] (1 species) |
Species Escherichia coli [TaxId:562] [46603] (2 PDB entries) |
Domain d1e52a_: 1e52 A: [59256] |
PDB Entry: 1e52 (more details)
SCOPe Domain Sequences for d1e52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas
Timeline for d1e52a_: