Lineage for d1e52a_ (1e52 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690008Superfamily a.2.9: C-terminal UvrC-binding domain of UvrB [46600] (1 family) (S)
  5. 2690009Family a.2.9.1: C-terminal UvrC-binding domain of UvrB [46601] (1 protein)
  6. 2690010Protein C-terminal UvrC-binding domain of UvrB [46602] (1 species)
  7. 2690011Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)
  8. 2690014Domain d1e52a_: 1e52 A: [59256]

Details for d1e52a_

PDB Entry: 1e52 (more details)

PDB Description: solution structure of escherichia coli uvrb c-terminal domain
PDB Compounds: (A:) excinuclease abc subunit

SCOPe Domain Sequences for d1e52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]}
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

SCOPe Domain Coordinates for d1e52a_:

Click to download the PDB-style file with coordinates for d1e52a_.
(The format of our PDB-style files is described here.)

Timeline for d1e52a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e52b_