Lineage for d1e52a_ (1e52 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 44819Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 44889Superfamily a.2.9: C-terminal, UvrC-binding domain of UvrB [46600] (1 family) (S)
  5. 44890Family a.2.9.1: C-terminal, UvrC-binding domain of UvrB [46601] (1 protein)
  6. 44891Protein C-terminal, UvrC-binding domain of UvrB [46602] (1 species)
  7. 44892Species Escherichia coli [TaxId:562] [46603] (2 PDB entries)
  8. 44893Domain d1e52a_: 1e52 A: [59256]

Details for d1e52a_

PDB Entry: 1e52 (more details)

PDB Description: solution structure of escherichia coli uvrb c-terminal domain

SCOP Domain Sequences for d1e52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e52a_ a.2.9.1 (A:) C-terminal, UvrC-binding domain of UvrB {Escherichia coli}
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

SCOP Domain Coordinates for d1e52a_:

Click to download the PDB-style file with coordinates for d1e52a_.
(The format of our PDB-style files is described here.)

Timeline for d1e52a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e52b_