PDB entry 1e52

View 1e52 on RCSB PDB site
Description: Solution structure of Escherichia coli UvrB C-terminal domain
Class: DNA excision repair
Keywords: DNA excision repair, uvrb, DNA repair, uvrc binding domain
Deposited on 2000-07-14, released 2001-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: excinuclease abc subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: uvrB
    Database cross-references and differences (RAF-indexed):
    • PDB 1E52
      • conflict (7)
    • Uniprot P07025 (7-62)
    Domains in SCOPe 2.08: d1e52a_
  • Chain 'B':
    Compound: excinuclease abc subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: uvrB
    Database cross-references and differences (RAF-indexed):
    • PDB 1E52
      • conflict (7)
    • Uniprot P07025 (7-62)
    Domains in SCOPe 2.08: d1e52b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1e52A (A:)
mhhhhhhlepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfi
aas

    Sequence, based on observed residues (ATOM records): (download) 
    >1e52A (A:)
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1e52B (B:)
mhhhhhhlepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfi
aas

    Sequence, based on observed residues (ATOM records): (download) 
    >1e52B (B:)
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas