Lineage for d1bmxa_ (1bmx A:)

  1. Root: SCOPe 2.08
  2. Class j: Peptides [58231] (151 folds)
  3. Fold j.47: Capsid protein major homology region peptide analog [58629] (1 superfamily)
  4. Superfamily j.47.1: Capsid protein major homology region peptide analog [58630] (1 family) (S)
  5. Family j.47.1.1: Capsid protein major homology region peptide analog [58631] (1 protein)
  6. Protein Capsid protein major homology region peptide analog [58632] (2 species)
  7. Species Human immunodeficiency virus type 1, HIV-1 [TaxId:11676] [58634] (1 PDB entry)
  8. Domain d1bmxa_: 1bmx A: [46326]

Details for d1bmxa_

PDB Entry: 1bmx (more details)

PDB Description: hiv-1 capsid protein major homology region peptide analog, nmr, 8 structures
PDB Compounds: (A:) human immunodeficiency virus type 1 capsid

SCOPe Domain Sequences for d1bmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmxa_ j.47.1.1 (A:) Capsid protein major homology region peptide analog {Human immunodeficiency virus type 1, HIV-1 [TaxId: 11676]}
csildirqgpkepfrdyvdrfyktlraeqas

SCOPe Domain Coordinates for d1bmxa_ are not available.

Timeline for d1bmxa_: