Lineage for d1bmxa_ (1bmx A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651357Fold j.47: Capsid protein major homology region peptide analog [58629] (1 superfamily)
  4. 2651358Superfamily j.47.1: Capsid protein major homology region peptide analog [58630] (1 family) (S)
  5. 2651359Family j.47.1.1: Capsid protein major homology region peptide analog [58631] (1 protein)
  6. 2651360Protein Capsid protein major homology region peptide analog [58632] (2 species)
  7. 2651361Species Human immunodeficiency virus type 1, HIV-1 [TaxId:11676] [58634] (1 PDB entry)
  8. 2651362Domain d1bmxa_: 1bmx A: [46326]

Details for d1bmxa_

PDB Entry: 1bmx (more details)

PDB Description: hiv-1 capsid protein major homology region peptide analog, nmr, 8 structures
PDB Compounds: (A:) human immunodeficiency virus type 1 capsid

SCOPe Domain Sequences for d1bmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmxa_ j.47.1.1 (A:) Capsid protein major homology region peptide analog {Human immunodeficiency virus type 1, HIV-1 [TaxId: 11676]}
csildirqgpkepfrdyvdrfyktlraeqas

SCOPe Domain Coordinates for d1bmxa_:

Click to download the PDB-style file with coordinates for d1bmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bmxa_: