PDB entry 1bmx

View 1bmx on RCSB PDB site
Description: hiv-1 capsid protein major homology region peptide analog, nmr, 8 structures
Class: Viral protein
Keywords: HIV, VIRAL CAPSID, P24, MHR, MAJOR HOMOLOGY REGION, Viral protein
Deposited on 1998-07-27, released 1999-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human immunodeficiency virus type 1 capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76258 (0-30)
      • conflict (1)
    Domains in SCOPe 2.07: d1bmxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmxA (A:)
    csildirqgpkepfrdyvdrfyktlraeqas