SCOPe 2.08: Domain d1afoa_: 1afo A:

Lineage for d1afoa_ (1afo A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)

4. Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family)

5. Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
   the member of this family may be not related

6. Protein Dimeric transmembrane domain of glycophorin A [58532] (1 species)
   right-hand twisted coiled coil

7. Species Human (Homo sapiens) [TaxId:9606] [58533] (1 PDB entry)

8. Domain d1afoa_: 1afo A: [46257]

Details for d1afoa_

PDB Entry: 1afo

PDB Description: dimeric transmembrane domain of human glycophorin a, nmr, 20 structures

PDB Compounds: (A:) glycophorin a

SCOPe Domain Sequences for d1afoa_:

Sequence; same for both SEQRES and ATOM records:

>d1afoa_ j.35.1.1 (A:) Dimeric transmembrane domain of glycophorin A {Human (Homo sapiens) [TaxId: 9606]}
vqlahhfsepeitliifgvmagvigtillisygirrlikk

Timeline for d1afoa_:

• d1afoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1afoa_ appears in SCOPe 2.07