PDB entry 1afo

View 1afo on RCSB PDB site
Description: dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Class: integral membrane protein
Keywords: integral membrane protein, human glycophorin a, transmembrane helix interactions, membrane protein folding
Deposited on 1997-03-11, released 1997-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glycophorin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02724 (0-39)
  Domains in SCOPe 2.08: d1afoa_
• Chain 'B':
  Compound: glycophorin a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02724 (0-39)
  Domains in SCOPe 2.08: d1afob_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1afoA (A:)
  vqlahhfsepeitliifgvmagvigtillisygirrlikk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1afoB (B:)
  vqlahhfsepeitliifgvmagvigtillisygirrlikk