Lineage for d1afoa_ (1afo A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651066Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 2651067Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 2651068Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 2651116Protein Dimeric transmembrane domain of glycophorin A [58532] (1 species)
    right-hand twisted coiled coil
  7. 2651117Species Human (Homo sapiens) [TaxId:9606] [58533] (1 PDB entry)
  8. 2651118Domain d1afoa_: 1afo A: [46257]

Details for d1afoa_

PDB Entry: 1afo (more details)

PDB Description: dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
PDB Compounds: (A:) glycophorin a

SCOPe Domain Sequences for d1afoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afoa_ j.35.1.1 (A:) Dimeric transmembrane domain of glycophorin A {Human (Homo sapiens) [TaxId: 9606]}
vqlahhfsepeitliifgvmagvigtillisygirrlikk

SCOPe Domain Coordinates for d1afoa_:

Click to download the PDB-style file with coordinates for d1afoa_.
(The format of our PDB-style files is described here.)

Timeline for d1afoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1afob_