SCOPe 2.08: Domain d1zwea_: 1zwe A:

Lineage for d1zwea_ (1zwe A:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)

4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family)

5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)

6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)

8. Domain d1zwea_: 1zwe A: [46160]

Details for d1zwea_

PDB Entry: 1zwe

PDB Description: structure of human parathyroid hormone fragment 4-37, nmr, 10 structures

PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1zwea_:

Sequence; same for both SEQRES and ATOM records:

>d1zwea_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
eiqlmhnlgkhlnsmervewlrkklqdvhnfval

Timeline for d1zwea_:

• d1zwea_ first appeared (with stable ids) in SCOP 1.55, called d1zwe__
  
• d1zwea_ appears in SCOPe 2.07