Lineage for d1zwe__ (1zwe -)

  1. Root: SCOP 1.55
  2. Class j: Peptides [58231] (77 folds)
  3. Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. Domain d1zwe__: 1zwe - [46160]

Details for d1zwe__

PDB Entry: 1zwe (more details)

PDB Description: structure of human parathyroid hormone fragment 4-37, nmr, 10 structures

SCOP Domain Sequences for d1zwe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwe__ j.15.1.1 (-) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens)}
eiqlmhnlgkhlnsmervewlrkklqdvhnfval

SCOP Domain Coordinates for d1zwe__ are not available.

Timeline for d1zwe__: