Lineage for d1zwea_ (1zwe A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2650761Fold j.15: Parathyroid hormone fragments (residues between 1 and 39) [58378] (1 superfamily)
  4. 2650762Superfamily j.15.1: Parathyroid hormone fragments (residues between 1 and 39) [58379] (1 family) (S)
  5. 2650763Family j.15.1.1: Parathyroid hormone fragments (residues between 1 and 39) [58380] (1 protein)
  6. 2650764Protein Parathyroid hormone fragments (residues between 1 and 39) [58381] (3 species)
  7. 2650767Species Human (Homo sapiens) [TaxId:9606] [58382] (14 PDB entries)
  8. 2650779Domain d1zwea_: 1zwe A: [46160]

Details for d1zwea_

PDB Entry: 1zwe (more details)

PDB Description: structure of human parathyroid hormone fragment 4-37, nmr, 10 structures
PDB Compounds: (A:) parathyroid hormone

SCOPe Domain Sequences for d1zwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwea_ j.15.1.1 (A:) Parathyroid hormone fragments (residues between 1 and 39) {Human (Homo sapiens) [TaxId: 9606]}
eiqlmhnlgkhlnsmervewlrkklqdvhnfval

SCOPe Domain Coordinates for d1zwea_:

Click to download the PDB-style file with coordinates for d1zwea_.
(The format of our PDB-style files is described here.)

Timeline for d1zwea_: