Lineage for d1hqmb_ (1hqm B:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206804Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 206805Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 206806Family i.8.1.1: RNA polymerase [58182] (1 protein)
  6. 206807Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. 206808Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries)
  8. 206822Domain d1hqmb_: 1hqm B: [45973]

Details for d1hqmb_

PDB Entry: 1hqm (more details), 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information

SCOP Domain Sequences for d1hqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqmb_ i.8.1.1 (B:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus}
esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvl
hefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveim
npdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqved
trlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasl

SCOP Domain Coordinates for d1hqmb_:

Click to download the PDB-style file with coordinates for d1hqmb_.
(The format of our PDB-style files is described here.)

Timeline for d1hqmb_: