| Class i: Low resolution protein structures [58117] (17 folds) |
| Fold i.8: RNA polymerase [58180] (1 superfamily) |
Superfamily i.8.1: RNA polymerase [58181] (1 family) ![]() |
| Family i.8.1.1: RNA polymerase [58182] (1 protein) |
| Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species) |
| Species Thermus aquaticus [TaxId:271] [58184] (3 PDB entries) |
| Domain d1hqme_: 1hqm E: [45976] |
PDB Entry: 1hqm (more details), 3.3 Å
SCOP Domain Sequences for d1hqme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqme_ i.8.1.1 (E:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypteee
Timeline for d1hqme_:
View in 3DDomains from other chains: (mouse over for more information) d1hqma_, d1hqmb_, d1hqmc_, d1hqmd_ |