Lineage for d1hqmb_ (1hqm B:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. Protein DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits [58183] (1 species)
  7. Species Thermus aquaticus [TaxId:271] [58184] (1 PDB entry)
  8. Domain d1hqmb_: 1hqm B: [45973]

Details for d1hqmb_

PDB Entry: 1hqm (more details), 3.3 Å

PDB Description: crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)- further refined from original deposition-contains additional sequence information

SCOP Domain Sequences for d1hqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqmb_ i.8.1.1 (B:) DNA-directed RNA polymerase alpha(2), beta, beta-prime and omega subunits {Thermus aquaticus}
esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvl
hefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveim
npdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqved
trlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasl

SCOP Domain Coordinates for d1hqmb_ are not available.

Timeline for d1hqmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hqma_, d1hqmc_, d1hqmd_, d1hqme_