![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
![]() | Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
![]() | Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
![]() | Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species) |
![]() | Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry) |
![]() | Domain d1d3e1_: 1d3e 1: [45944] |
PDB Entry: 1d3e (more details), 28 Å
SCOPe Domain Sequences for d1d3e1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3e1_ i.6.1.1 (1:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16 [TaxId: 31708]} apvaayvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka khtkawcprppravqyshthttnyklssevhndvairprtnlttv
Timeline for d1d3e1_:
![]() Domains from other chains: (mouse over for more information) d1d3e2_, d1d3e3_, d1d3e4_, d1d3ei_ |