Lineage for d1d3e2_ (1d3e 2:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649079Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 2649080Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 2649081Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 2649118Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species)
  7. 2649119Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry)
  8. 2649121Domain d1d3e2_: 1d3e 2: [45945]

Details for d1d3e2_

PDB Entry: 1d3e (more details), 28 Å

PDB Description: cryo-em structure of human rhinovirus 16 (hrv16) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only
PDB Compounds: (2:) protein (rhinovirus 16 coat protein vp2)

SCOPe Domain Sequences for d1d3e2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3e2_ i.6.1.1 (2:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16 [TaxId: 31708]}
sdriiqitrgdstitsqdvanavvgygvwphyltpqdataidkptqpdtssnrfytldsk
mwnstskgwwwklpdalkdmgifgenmfyhflgrsgytvhvqcnaskfhqgtllvvmipe
hqlatvnkgnvnagykythpgeagrevgtaaaaekqpsddnwlnfdgtllgnllifphqf
inlrsnnsatlivpyvnavpmdsmvrhnnwslviipvcqlqsnnisnivpitvsispmca
efsgaraktvvq

SCOPe Domain Coordinates for d1d3e2_:

Click to download the PDB-style file with coordinates for d1d3e2_.
(The format of our PDB-style files is described here.)

Timeline for d1d3e2_: