Lineage for d1d3e1_ (1d3e 1:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044501Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 3044502Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 3044503Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 3044540Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species)
  7. 3044541Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry)
  8. 3044542Domain d1d3e1_: 1d3e 1: [45944]

Details for d1d3e1_

PDB Entry: 1d3e (more details)

PDB Description: cryo-em structure of human rhinovirus 16 (hrv16) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only
PDB Compounds: (1:) protein (rhinovirus 16 coat protein vp1)

SCOPe Domain Sequences for d1d3e1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3e1_ i.6.1.1 (1:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16 [TaxId: 31708]}
apvaayvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv

SCOPe Domain Coordinates for d1d3e1_:

Click to download the PDB-style file with coordinates for d1d3e1_.
(The format of our PDB-style files is described here.)

Timeline for d1d3e1_: