Lineage for d1d3e1_ (1d3e 1:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 273319Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 273320Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 273321Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)
  6. 273358Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species)
  7. 273359Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry)
  8. 273360Domain d1d3e1_: 1d3e 1: [45944]

Details for d1d3e1_

PDB Entry: 1d3e (more details)

PDB Description: cryo-em structure of human rhinovirus 16 (hrv16) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

SCOP Domain Sequences for d1d3e1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3e1_ i.6.1.1 (1:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16}
apvaayvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv

SCOP Domain Coordinates for d1d3e1_:

Click to download the PDB-style file with coordinates for d1d3e1_.
(The format of our PDB-style files is described here.)

Timeline for d1d3e1_: