SCOP 1.65: Domain d1d3e1_: 1d3e 1:

Lineage for d1d3e1_ (1d3e 1:)

1. Root: SCOP 1.65

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)

6. Protein HRV16 complexed with d1d2-ICAM-1 [58165] (1 species)

7. Species Human rhinovirus 16 [TaxId:31708] [58166] (1 PDB entry)

8. Domain d1d3e1_: 1d3e 1: [45944]

Details for d1d3e1_

PDB Entry: 1d3e

PDB Description: cryo-em structure of human rhinovirus 16 (hrv16) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

SCOP Domain Sequences for d1d3e1_:

Sequence; same for both SEQRES and ATOM records:

>d1d3e1_ i.6.1.1 (1:) HRV16 complexed with d1d2-ICAM-1 {Human rhinovirus 16}
apvaayvdevlnevlvvpninqshpttsnaapvldaaetghtnkiqpedtietryvqssq
tldemsvesflgrsgcihesvldivdnyndqsftkwninlqemaqirrkfemftyarfds
eitmvpsvaakdghighivmqymyvppgapipttrddyawqsgtnasvfwqhgqpfprfs
lpflsiasayymfydgydgdtyksrygtvvtndmgtlcsrivtseqlhkvkvvtriyhka
khtkawcprppravqyshthttnyklssevhndvairprtnlttv

Timeline for d1d3e1_:

• d1d3e1_ first appeared (with stable ids) in SCOP 1.55
  
• d1d3e1_ appears in SCOP 1.63
  
• d1d3e1_ appears in SCOP 1.67
  
• d1d3e1_ appears in the current release, SCOPe 2.08