Lineage for d1swic_ (1swi C:)
- Root: SCOP 1.61
Class h: Coiled coil proteins [57942] (5 folds) 
Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) 
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) 
Family h.1.3.1: Leucine zipper domain [57960] (13 proteins) Protein GCN4 [57961] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries) 
Domain d1swic_: 1swi C: [45505]
Details for d1swic_
PDB Entry: 1swi (more details), 2.6 Å
PDB Description: gcn4-leucine zipper core mutant as n16a complexed with benzene
SCOP Domain Sequences for d1swic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1swic_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskayhlenevarlkklv
SCOP Domain Coordinates for d1swic_:
Click to download the PDB-style file with coordinates for d1swic_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1swic_:
- d1swic_ first appeared (with stable ids) in SCOP 1.55
- d1swic_ appears in SCOP 1.59
- d1swic_ appears in SCOP 1.63
- d1swic_ appears in the current release, SCOPe 2.08
View in 3D
