SCOP 1.61: Domain d1swia_: 1swi A:

Lineage for d1swia_ (1swi A:)

1. Root: SCOP 1.61

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)

6. Protein GCN4 [57961] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)

8. Domain d1swia_: 1swi A: [45503]

Details for d1swia_

PDB Entry: 1swi, 2.6 Å

PDB Description: gcn4-leucine zipper core mutant as n16a complexed with benzene

SCOP Domain Sequences for d1swia_:

Sequence; same for both SEQRES and ATOM records:

>d1swia_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskayhlenevarlkklvg

Timeline for d1swia_:

• d1swia_ first appeared (with stable ids) in SCOP 1.55
  
• d1swia_ appears in SCOP 1.59
  
• d1swia_ appears in SCOP 1.63
  
• d1swia_ appears in the current release, SCOPe 2.08