Lineage for d1swia_ (1swi A:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145470Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 145471Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 145513Protein GCN4 [57961] (1 species)
  7. 145514Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 145579Domain d1swia_: 1swi A: [45503]

Details for d1swia_

PDB Entry: 1swi (more details), 2.6 Å

PDB Description: gcn4-leucine zipper core mutant as n16a complexed with benzene

SCOP Domain Sequences for d1swia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swia_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskayhlenevarlkklvg

SCOP Domain Coordinates for d1swia_:

Click to download the PDB-style file with coordinates for d1swia_.
(The format of our PDB-style files is described here.)

Timeline for d1swia_: