Lineage for d1swic_ (1swi C:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. Protein GCN4 [57961] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (16 PDB entries)
  8. Domain d1swic_: 1swi C: [45505]

Details for d1swic_

PDB Entry: 1swi (more details), 2.6 Å

PDB Description: gcn4-leucine zipper core mutant as n16a complexed with benzene

SCOP Domain Sequences for d1swic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swic_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellskayhlenevarlkklv

SCOP Domain Coordinates for d1swic_ are not available.

Timeline for d1swic_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1swia_, d1swib_