Lineage for d1adva3 (1adv A:386-529)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41842Fold g.51: Zn-binding domains of ADDBP [57916] (1 superfamily)
  4. 41843Superfamily g.51.1: Zn-binding domains of ADDBP [57917] (1 family) (S)
  5. 41844Family g.51.1.1: Zn-binding domains of ADDBP [57918] (2 proteins)
  6. 41853Protein Second Zn-domain of early E2A DNA-binding protein, ADDBP [57921] (1 species)
  7. 41854Species Human adenovirus type 5 [TaxId:28285] [57922] (4 PDB entries)
  8. 41859Domain d1adva3: 1adv A:386-529 [45372]
    Other proteins in same PDB: d1adva1, d1adva2, d1advb1, d1advb2

Details for d1adva3

PDB Entry: 1adv (more details), 3.2 Å

PDB Description: early e2a dna-binding protein

SCOP Domain Sequences for d1adva3:

Sequence, based on SEQRES records: (download)

>d1adva3 g.51.1.1 (A:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5}
ghghllmplrcecnskpghapflgrqlpkltpfalsnaedldadlisdksvlasvhhpal
ivfqccnpvyrnsraqgggpncdfkisapdllnalvmvrslwsenftelprmvvpefkws
tkhqyrnvslpvahsdarqnpfdf

Sequence, based on observed residues (ATOM records): (download)

>d1adva3 g.51.1.1 (A:386-529) Second Zn-domain of early E2A DNA-binding protein, ADDBP {Human adenovirus type 5}
ghghllmplrcecnspflgrqlpkltpfalsnaedldksvlasvhhpalivfqccnppnc
dfkisapdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpf
df

SCOP Domain Coordinates for d1adva3:

Click to download the PDB-style file with coordinates for d1adva3.
(The format of our PDB-style files is described here.)

Timeline for d1adva3: