Lineage for d1rmda2 (1rmd A:1-86)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1966943Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1966944Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1966945Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 1966997Protein V(D)J recombination activating protein 1 (RAG1), dimerization domain [57854] (1 species)
  7. 1966998Species Mouse (Mus musculus) [TaxId:10090] [57855] (1 PDB entry)
  8. 1966999Domain d1rmda2: 1rmd A:1-86 [45322]
    Other proteins in same PDB: d1rmda1
    include dimerization helices
    complexed with zn

Details for d1rmda2

PDB Entry: 1rmd (more details), 2.1 Å

PDB Description: rag1 dimerization domain
PDB Compounds: (A:) rag1

SCOPe Domain Sequences for d1rmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
ncskihlstkllavdfpahfvksiscqicehiladpvetsckhlfcricilrclkvmgsy
cpscrypcfptdlespvksflnilns

SCOPe Domain Coordinates for d1rmda2:

Click to download the PDB-style file with coordinates for d1rmda2.
(The format of our PDB-style files is described here.)

Timeline for d1rmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rmda1