PDB entry 1rmd

View 1rmd on RCSB PDB site
Description: rag1 dimerization domain
Class: DNA-binding protein
Keywords: rag1, v(d)j recombination, antibody, mad, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein
Deposited on 1997-01-10, released 1997-07-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rag1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rmda1, d1rmda2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmdA (A:)
    ncskihlstkllavdfpahfvksiscqicehiladpvetsckhlfcricilrclkvmgsy
    cpscrypcfptdlespvksflnilnslmvkcpaqdcneevslekynhhvsshkesk