Lineage for d1rmda1 (1rmd A:87-116)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964751Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1964752Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1964753Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1964852Protein V(D)J recombination activating protein 1 (RAG1), dimerization domain [57671] (1 species)
  7. 1964853Species Mouse (Mus musculus) [TaxId:10090] [57672] (1 PDB entry)
  8. 1964854Domain d1rmda1: 1rmd A:87-116 [45025]
    Other proteins in same PDB: d1rmda2
    complexed with zn

Details for d1rmda1

PDB Entry: 1rmd (more details), 2.1 Å

PDB Description: rag1 dimerization domain
PDB Compounds: (A:) rag1

SCOPe Domain Sequences for d1rmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmda1 g.37.1.1 (A:87-116) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
lmvkcpaqdcneevslekynhhvsshkesk

SCOPe Domain Coordinates for d1rmda1:

Click to download the PDB-style file with coordinates for d1rmda1.
(The format of our PDB-style files is described here.)

Timeline for d1rmda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rmda2