| Class g: Small proteins [56992] (100 folds) |
| Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
| Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
| Protein V(D)J recombination activating protein 1 (RAG1), dimerization domain [57854] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [57855] (1 PDB entry) |
| Domain d1rmda2: 1rmd A:1-86 [45322] Other proteins in same PDB: d1rmda1 include dimerization helices complexed with zn |
PDB Entry: 1rmd (more details), 2.1 Å
SCOPe Domain Sequences for d1rmda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
ncskihlstkllavdfpahfvksiscqicehiladpvetsckhlfcricilrclkvmgsy
cpscrypcfptdlespvksflnilns
Timeline for d1rmda2: