![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.42: Ribosomal protein L36 [57839] (1 superfamily) zinc-bound beta-ribbon motif |
![]() | Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) ![]() automatically mapped to Pfam PF00444 |
![]() | Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein) |
![]() | Protein Ribosomal protein L36 [57842] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [57843] (10 PDB entries) |
![]() | Domain d1dfea_: 1dfe A: [45318] complexed with zn |
PDB Entry: 1dfe (more details)
SCOPe Domain Sequences for d1dfea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfea_ g.42.1.1 (A:) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]} mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg
Timeline for d1dfea_: