PDB entry 1dfe

View 1dfe on RCSB PDB site
Description: nmr structure of ribosomal protein l36 from thermus thermophilus
Class: ribosome
Keywords: ANTI-PARALLEL BETA SHEET, ZINC BINDING, ribosome
Deposited on 1999-11-19, released 1999-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l36 ribosomal protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfea_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dfeA (A:)
    mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg