Lineage for d1dfea_ (1dfe A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41721Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
  4. 41722Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
  5. 41723Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 41724Protein Ribosomal protein L36 [57842] (1 species)
  7. 41725Species Thermus thermophilus [TaxId:274] [57843] (2 PDB entries)
  8. 41726Domain d1dfea_: 1dfe A: [45318]

Details for d1dfea_

PDB Entry: 1dfe (more details)

PDB Description: nmr structure of ribosomal protein l36 from thermus thermophilus

SCOP Domain Sequences for d1dfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfea_ g.42.1.1 (A:) Ribosomal protein L36 {Thermus thermophilus}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOP Domain Coordinates for d1dfea_:

Click to download the PDB-style file with coordinates for d1dfea_.
(The format of our PDB-style files is described here.)

Timeline for d1dfea_: